PBOV1 Rabbit Polyclonal Antibody

SKU TA331281

Rabbit Polyclonal Anti-PBOV1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PBOV1 antibody is: synthetic peptide directed towards the N-terminal region of Human PBOV1. Synthetic peptide located within the following region: RAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 16 kDa
• Gene Name: prostate and breast cancer overexpressed 1
• Database Link:
  NP_067648
  Q9GZY1
• Background: This intronless gene encodes a protein of unknown function. Its expression is up-regulated in some types of cancer, including prostate, breast, and bladder cancer.
• Synonyms: dJ171N11.2; UC28; UROC28
• Note: Human: 100%

Reference Data