G protein alpha 13 (GNA13) Rabbit Polyclonal Antibody

SKU TA331256

Rabbit Polyclonal Anti-GNA13 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GNA13 antibody is: synthetic peptide directed towards the N-terminal region of Human GNA13. Synthetic peptide located within the following region: GCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: G protein subunit alpha 13
• Database Link:
  NP_006563
  Q14344
• Background: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
• Synonyms: G13
• Note: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 83%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Long-term depression, Regulation of actin cytoskeleton, Vascular smooth muscle contraction