CABP5 Rabbit Polyclonal Antibody

SKU TA331245

Rabbit Polyclonal Anti-CABP5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CABP5 antibody is: synthetic peptide directed towards the N-terminal region of Human CABP5. Synthetic peptide located within the following region: RKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 20 kDa
• Gene Name: calcium binding protein 5
• Database Link:
  NP_062829
  Q9NP86
• Background: The product of this gene belongs to a subfamily of calcium binding proteins, which share similarity to calmodulin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Expression of this gene is retina-specific. The mouse homolog of this protein has been shown to express in the inner nuclear layer of the retina, suggested its role in neuronal functioning. The specific function of this gene is unknown.
• Synonyms: CABP3
• Note: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 92%; Mouse: 86%

Reference Data