WHAMM Rabbit Polyclonal Antibody

SKU TA331240

Rabbit Polyclonal Anti-WHAMM Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-WHAMM antibody is: synthetic peptide directed towards the C-terminal region of Human WHAMM. Synthetic peptide located within the following region: SEAGNVKSPKCQNCHGNIPVQVFVPVGDQTHSKSSEELSLPPPPPPPPPP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 91 kDa
• Gene Name: WAS protein homolog associated with actin, golgi membranes and microtubules
• Database Link:
  NP_001073904
  Q8TF30
• Background: WHAMM acts as a nucleation-promoting factor (NPF) that stimulates Arp2/3-mediated actin polymerization both at the Golgi apparatus and along tubular membranes. WHAMM is involved as a regulator of Golgi positioning and morphology. WHAMM participates in vesicle transport between the reticulum endoplasmic and the Golgi complex.
• Synonyms: WHAMM1; WHDC1
• Note: Human: 100%; Horse: 93%; Dog: 86%; Pig: 86%; Rat: 85%

Reference Data