Rab6b Rabbit Polyclonal Antibody

SKU TA331219

Rabbit Polyclonal Anti-Rab6b Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Rab6b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rab6b. Synthetic peptide located within the following region: KTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 22 kDa
• Gene Name: RAB6B, member RAS oncogene family
• Database Link:
  NP_776142
  P61294
• Background: Rab6b seems to have a role in retrograde membrane traffic at the level of the Golgi complex. It may function in retrograde transport in neuronal cells.
• Synonyms: RAB6B
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data