NCLN Rabbit Polyclonal Antibody

SKU TA331215

Rabbit Polyclonal Anti-NCLN Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NCLN antibody is: synthetic peptide directed towards the C-terminal region of Human NCLN. Synthetic peptide located within the following region: DKDSTFLSTLEHHLSRYLKDVKQHHVKADKRDPEFVFYDQLKQVMNAYRV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 59 kDa
• Gene Name: nicalin
• Database Link:
  NP_064555
  Q969V3
• Background: NCLN may antagonize Nodal signaling and subsequent organization of axial structures during mesodermal patterning.
• Synonyms: NET59
• Note: Pig: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Rat: 93%; Bovine: 93%; Guinea pig: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane