GSDMA Rabbit Polyclonal Antibody

SKU TA331208

Rabbit Polyclonal Anti-GSDMA Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GSDMA antibody is: synthetic peptide directed towards the C-terminal region of Human GSDMA. Synthetic peptide located within the following region: ICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: gasdermin A
• Database Link:
  NP_835465
  Q96QA5
• Background: GSDMA induces apoptosis.
• Synonyms: FKSG9; GSDM; GSDM1
• Note: Human: 100%; Pig: 85%; Rat: 85%; Horse: 85%; Mouse: 85%; Rabbit: 85%; Guinea pig: 85%

Reference Data