CAPN8 Rabbit Polyclonal Antibody

SKU TA331199

Rabbit Polyclonal Anti-CAPN8 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CAPN8 antibody is: synthetic peptide directed towards the middle region of Human CAPN8. Synthetic peptide located within the following region: KLIRLRNPWGEVEWSGAWSDDAPEWNHIDPRRKEELDKKVEDGEFWMSLS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 77 kDa
• Gene Name: calpain 8
• Database Link:
  NP_001137434
  A6NHC0
• Background: CAPN8 is a calcium-regulated non-lysosomal thiol-protease. CAPN8 is involved in membrane trafficking in the gastric surface mucus cells (pit cells) and may involve the membrane trafficking of mucus cells via interactions with coat protein. CAPN8 proteolytically cleaves the beta-subunit of coatomer complex.
• Synonyms: nCL-2
• Note: Human: 100%; Rat: 93%; Rabbit: 93%; Pig: 79%; Horse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome