BUD23 Rabbit Polyclonal Antibody

SKU TA331196

Rabbit Polyclonal Anti-WDHD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WDHD1 antibody: synthetic peptide directed towards the middle region of human WDHD1. Synthetic peptide located within the following region: KQILHGDPLPLTRKSYLAWIGFSAEGTPCYVDSEGIVRMLNRGLGNTWTP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 126 kDa
• Gene Name: Williams-Beuren syndrome chromosome region 22
• Database Link:
  NP_059998
  O43709
• Background: WDHD1 contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. WDHD1 may also be involved in protein-protein interactions. The protein encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms.
• Synonyms: HASJ4442; HUSSY-3; MERM1; PP3381; WBMT
• Note: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Androgen and estrogen metabolism, Histidine metabolism, Selenoamino acid metabolism, Tyrosine metabolism