ACADM Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ACADM antibody: synthetic peptide directed towards the N terminal of human ACADM. Synthetic peptide located within the following region: ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 47 kDa |
Gene Name | acyl-CoA dehydrogenase, C-4 to C-12 straight chain |
Database Link | |
Background | ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency. |
Synonyms | ACAD1; MCAD; MCADH |
Note | Dog: 100%; Human: 100%; Pig: 92%; Horse: 92%; Mouse: 92%; Yeast: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 85%; Rat: 83% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | beta-Alanine metabolism, Fatty acid metabolism, leucine and isoleucine degradation, Metabolic pathways, PPAR signaling pathway, Propanoate metabolism, Valine |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.