ACADM Rabbit Polyclonal Antibody

SKU
TA331168
Rabbit Polyclonal Anti-ACADM Antibody
$525.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ACADM antibody: synthetic peptide directed towards the N terminal of human ACADM. Synthetic peptide located within the following region: ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 47 kDa
Gene Name acyl-CoA dehydrogenase, C-4 to C-12 straight chain
Database Link
Background ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency.
Synonyms ACAD1; MCAD; MCADH
Note Dog: 100%; Human: 100%; Pig: 92%; Horse: 92%; Mouse: 92%; Yeast: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 85%; Rat: 83%
Reference Data
Protein Families Druggable Genome
Protein Pathways beta-Alanine metabolism, Fatty acid metabolism, leucine and isoleucine degradation, Metabolic pathways, PPAR signaling pathway, Propanoate metabolism, Valine
Write Your Own Review
You're reviewing:ACADM Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.