MLLT1 Rabbit Polyclonal Antibody

SKU
TA331116
Rabbit Polyclonal Anti-MLLT1 Antibody
$525.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MLLT1 antibody: synthetic peptide directed towards the middle region of human MLLT1. Synthetic peptide located within the following region: EESNSEDEASFKSESAQSSPSNSSSSSDSSSDSDFEPSQNHSQGPLRSMV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 62 kDa
Gene Name myeloid/lymphoid or mixed-lineage leukemia; translocated to, 1
Database Link
Background MLLT1 is a homolog of the yeast SWI/SNF subunit, ANC1/TFG3. Moreover, MLLT0 is a fusion partner for the gene product of MLL that is a common target for chromosomal translocations in human acute leukemia
Synonyms ENL; LTG19; YEATS1
Note Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 93%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:MLLT1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.