Methionyl tRNA synthetase (MARS) Rabbit Polyclonal Antibody

SKU TA331113

Rabbit Polyclonal Anti-MARS Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MARS antibody: synthetic peptide directed towards the middle region of human MARS. Synthetic peptide located within the following region: GHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 101 kDa
• Gene Name: methionyl-tRNA synthetase
• Database Link:
  NP_004981
  P56192
• Background: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. MARS belongs to the class I family of tRNA synthetases.Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene belongs to the class I family of tRNA synthetases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CMT2U; ILFS2; ILLD; METRS; MRS; MTRNS; SPG70
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Aminoacyl-tRNA biosynthesis, Selenoamino acid metabolism