ZNF589 Rabbit Polyclonal Antibody

SKU TA331099

Rabbit Polyclonal Anti-ZNF589 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF589 antibody is: synthetic peptide directed towards the C-terminal region of Human ZNF589. Synthetic peptide located within the following region: SCKPYLIRHQRTHTREKSFMCTVCGRGFREKSELIKHQRIHTGDKPYVCR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: zinc finger protein 589
• Database Link:
  NP_057173
  Q86UQ0
• Background: ZNF589 may play a role in hematopoietic stem/progenitor cell differentiation and may play a role as a DNA binding-dependent transcriptional repressor.
• Synonyms: SZF1
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors