TMEM126B Rabbit Polyclonal Antibody

SKU TA331045

Rabbit polyclonal Anti-TMEM126B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM126B antibody: synthetic peptide directed towards the N terminal of human TMEM126B. Synthetic peptide located within the following region: AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 23 kDa
• Gene Name: transmembrane protein 126B
• Database Link:
  NP_060950
  Q8IUX1
• Background: It belongs to the TMEM126 family. The function remains unknown.
• Synonyms: HT007
• Note: Human: 100%; Rabbit: 92%; Dog: 86%

Reference Data

• Protein Families: Transmembrane