C9ORF46 (PLGRKT) Rabbit Polyclonal Antibody

SKU
TA331042
Rabbit polyclonal Anti-C9orf46 Antibody
$575.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C9orf46 antibody: synthetic peptide directed towards the middle region of human C9orf46. Synthetic peptide located within the following region: GTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 17 kDa
Gene Name plasminogen receptor with a C-terminal lysine
Database Link
Background The exact function of C9orf46 remains unknown.
Synonyms AD025; C9orf46; MDS030; Plg-R(KT); PLG-RKT
Note Human: 100%; Rat: 92%; Bovine: 92%; Dog: 85%; Pig: 85%; Horse: 85%; Mouse: 85%; Rabbit: 85%; Guinea pig: 85%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:C9ORF46 (PLGRKT) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.