Methyltransferase like protein 10 (METTL10) Rabbit Polyclonal Antibody

SKU TA331027

Rabbit polyclonal Anti-METTL10 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-METTL10 antibody: synthetic peptide directed towards the N terminal of human LOC399818. Synthetic peptide located within the following region: SSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFRE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: methyltransferase like 10
• Database Link:
  NP_997719
  Q5JPI9
• Background: LOC399818 belongs to the methyltransferase superfamily
• Synonyms: C10orf138
• Note: Human: 100%

Reference Data

• Protein Families: Druggable Genome