Uap1l1 Rabbit Polyclonal Antibody

SKU
TA331025
Rabbit polyclonal Anti-Uap1l1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Uap1l1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KVPYVDEEGNLVKPLRPNGIKMEKFVFDVFQFAKNFVAFEVCREEEFSPL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 56 kDa
Gene Name UDP-N-acteylglucosamine pyrophosphorylase 1-like 1
Database Link
Background The function of this protein remains unknown.
Synonyms UAP1L1
Note Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Zebrafish: 83%
Reference Data
Write Your Own Review
You're reviewing:Uap1l1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.