GALNTL4 (GALNT18) Rabbit Polyclonal Antibody

SKU TA331019

Rabbit polyclonal Anti-GALNTL4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GALNTL4 antibody: synthetic peptide directed towards the middle region of human GALNTL4. Synthetic peptide located within the following region: IIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 69 kDa
• Gene Name: polypeptide N-acetylgalactosaminyltransferase 18
• Database Link:
  NP_940918
  Q6P9A2
• Background: GALNTL4 may catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.
• Synonyms: GalNAc-T15; GalNAc-T18; GALNACT18; GALNT15; GALNTL4
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, O-Glycan biosynthesis