C9orf96 (STKLD1) Rabbit Polyclonal Antibody

SKU TA330991

Rabbit polyclonal Anti-C9orf96 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C9orf96 antibody: synthetic peptide directed towards the C terminal of human C9orf96. Synthetic peptide located within the following region: AFKVVVQEEGGSGLSLIKETYQLHRDDPEVVENVGMLLVHLASYEEILPE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 76 kDa
• Gene Name: serine/threonine kinase-like domain containing 1
• Database Link:
  NP_714921
  Q8NE28
• Background: The function remains unknown.
• Synonyms: C9orf96; SgK071; Sk521
• Note: Human: 100%; Bovine: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Rat: 90%; Dog: 86%

Reference Data

• Protein Families: Protein Kinase