ARMC3 Rabbit Polyclonal Antibody

SKU TA330954

Rabbit polyclonal Anti-ARMC3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARMC3 antibody: synthetic peptide directed towards the middle region of human ARMC3. Synthetic peptide located within the following region: YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 96 kDa
• Gene Name: armadillo repeat containing 3
• Database Link:
  NP_775104
  Q5W041
• Background: The specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis.
• Synonyms: CT81; KU-CT-1
• Note: Human: 100%; Rat: 86%; Horse: 86%; Dog: 79%; Pig: 79%; Mouse: 79%; Bovine: 79%

Reference Data