Peptidase inhibitor 16 (PI16) Rabbit Polyclonal Antibody

SKU TA330942

Rabbit polyclonal Anti-PI16 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PI16 antibody: synthetic peptide directed towards the middle region of human PI16. Synthetic peptide located within the following region: SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 47 kDa
• Gene Name: peptidase inhibitor 16
• Database Link:
  NP_699201
  Q6UXB8
• Background: PI16 is a putative serine protease inhibitor. PI16 may serve as a marker following prostatectomy for prostate cancer.
• Synonyms: CD364; CRISP9; MSMBBP; PSPBP
• Note: Human: 100%; Dog: 93%; Horse: 92%; Pig: 77%

Reference Data

• Protein Families: Transmembrane