SFI1 Rabbit Polyclonal Antibody

SKU TA330911

Rabbit Polyclonal Anti-SFI1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SFI1 antibody is: synthetic peptide directed towards the C-terminal region of Human SFI1. Synthetic peptide located within the following region: LELNTAHSARKQPRRPHFLLEPAQSQRPQKPQEHGLGMAQPAAPSLTRPF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 133 kDa
• Gene Name: SFI1 centrin binding protein
• Database Link:
  NP_055590
  A8K8P3
• Background: SFI1 plays a role in the dynamic structure of centrosome-associated contractile fibers via its interaction with CETN2.
• Synonyms: hSfi1p; PISD; PPP1R139
• Note: Human: 100%; Dog: 83%

Reference Data