HEY1 Rabbit Polyclonal Antibody

SKU TA330897

Rabbit Polyclonal Anti-HEY1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HEY1 antibody is: synthetic peptide directed towards the N-terminal region of Human HEY1. Synthetic peptide located within the following region: SSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: hes related family bHLH transcription factor with YRPW motif 1
• Database Link:
  NP_036390
  Q9Y5J3
• Background: Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates.
• Synonyms: BHLHb31; CHF2; HERP2; HESR1; hHRT1; HRT-1; OAF1
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors