ZNF680 Rabbit Polyclonal Antibody

SKU TA330890

Rabbit Polyclonal Anti-ZNF680 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF680 antibody is: synthetic peptide directed towards the middle region of Human ZNF680. Synthetic peptide located within the following region: IRIHTRENSYKCEECGKVLNWFSELIKHKGIHMGEKPYKCEECGKAFNQS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: zinc finger protein 680
• Database Link:
  NP_848653
  Q8NEM1
• Background: ZNF680 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF680 may be involved in transcriptional regulation.
• Synonyms: FLJ90430
• Note: Human: 100%

Reference Data

• Protein Families: Transcription Factors