FOXD4L1 Rabbit Polyclonal Antibody

SKU TA330872

Rabbit Polyclonal Anti-FOXD4L1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FOXD4L1 antibody is: synthetic peptide directed towards the N-terminal region of Human FOXD4L1. Synthetic peptide located within the following region: PRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: forkhead box D4-like 1
• Database Link:
  NP_036316
  Q9NU39
• Background: This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer. This gene lies in a region of chromosome 2 that surrounds the site where two ancestral chromosomes fused to form human chromosome 2. This region is duplicated elsewhere in the human genome, primarily in subtelomeric and pericentromeric locations, thus mutiple copies of this gene have been found.
• Synonyms: bA395L14.1; FOXD5
• Note: Human: 100%; Pig: 86%; Bovine: 79%; Rabbit: 79%

Reference Data