CCDC85C Rabbit Polyclonal Antibody

SKU
TA330857
Rabbit Polyclonal Anti-CCDC85C Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CCDC85C antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC85C. Synthetic peptide located within the following region: HAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWRKLGDAASSK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 46 kDa
Gene Name coiled-coil domain containing 85C
Database Link
Background CCDC85C may play an important role in cortical development, especially in the maintenance of radial glia.
Synonyms FLJ22558; MGC117455
Note Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Write Your Own Review
You're reviewing:CCDC85C Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.