WDR31 Rabbit Polyclonal Antibody

SKU TA330822

Rabbit Polyclonal Anti-WDR31 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-WDR31 antibody is: synthetic peptide directed towards the middle region of Human WDR31. Synthetic peptide located within the following region: MWDLHGSSQPRQQLCGHAMVVTGLAVSPDSSQLCTGSRDNTLLLWDVVTG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: WD repeat domain 31
• Database Link:
  NP_660284
  Q8NA23
• Background: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene but the biological validity of some variants has not been determined.
• Synonyms: FLJ35921
• Note: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 92%; Bovine: 82%; Mouse: 79%

Reference Data