UTP11L (UTP11) Rabbit Polyclonal Antibody

SKU
TA330817
Rabbit Polyclonal Anti-UTP11L Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-UTP11L antibody is: synthetic peptide directed towards the N-terminal region of Human UTP11L. Synthetic peptide located within the following region: AKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 30 kDa
Gene Name UTP11, small subunit processome component homolog (S. cerevisiae)
Database Link
Background UTP11L is involved in nucleolar processing of pre-18S ribosomal RNA.
Synonyms CGI-94; CGI94; UTP11L
Note Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Yeast: 85%; Mouse: 79%; Zebrafish: 77%
Reference Data
Write Your Own Review
You're reviewing:UTP11L (UTP11) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.