UTP11L (UTP11) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-UTP11L antibody is: synthetic peptide directed towards the N-terminal region of Human UTP11L. Synthetic peptide located within the following region: AKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKA |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 30 kDa |
Gene Name | UTP11, small subunit processome component homolog (S. cerevisiae) |
Database Link | |
Background | UTP11L is involved in nucleolar processing of pre-18S ribosomal RNA. |
Synonyms | CGI-94; CGI94; UTP11L |
Note | Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Yeast: 85%; Mouse: 79%; Zebrafish: 77% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.