CLNMT (CAMKMT) Rabbit Polyclonal Antibody

SKU TA330751

Rabbit Polyclonal Anti-CAMKMT Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CAMKMT antibody is: synthetic peptide directed towards the C-terminal region of Human CAMKMT. Synthetic peptide located within the following region: QFCNLAEKAGFCIQRHENYDEHISNFHSKLKKENPDIYEENLHYPLLLIL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: calmodulin-lysine N-methyltransferase
• Database Link:
  NP_079042
  Q7Z624
• Background: This gene encodes a class I protein methyltransferase that acts in the formation of trimethyllysine in calmodulin. The protein contains a AdoMet-binding motif and may play a role in calcium-dependent signaling.
• Synonyms: C2orf34; Cam; CaM KMT; CLNMT; KMT
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Mouse: 92%

Reference Data