C1orf135 (AUNIP) Rabbit Polyclonal Antibody

SKU TA330724

Rabbit Polyclonal Anti-AUNIP Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AUNIP antibody is: synthetic peptide directed towards the N-terminal region of Human AUNIP. Synthetic peptide located within the following region: RAPSTGIHQRSIASFFTLQPGKTNGSDQKSVSSHTESQINKESKKNATQL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: aurora kinase A and ninein interacting protein
• Database Link:
  NP_076942
  Q9H7T9
• Background: AUNIP is required for the dynamic movement of AURKA at the centrosomes and spindle apparatus during the cell cycle.
• Synonyms: AIBP; C1orf135
• Note: Human: 100%; Pig: 86%; Horse: 86%; Rabbit: 85%; Dog: 79%; Bovine: 79%

Reference Data