MRPL44 Rabbit Polyclonal Antibody

SKU TA330720

Rabbit Polyclonal Anti-MRPL44 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MRPL44 antibody is: synthetic peptide directed towards the C-terminal region of Human MRPL44. Synthetic peptide located within the following region: EGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: mitochondrial ribosomal protein L44
• Database Link:
  NP_075066
  Q9H9J2
• Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.
• Synonyms: COXPD16; L44MT; MRP-L44
• Note: Human: 100%; Dog: 85%; Rabbit: 85%; Pig: 77%; Rat: 77%

Reference Data