CBWD1 Rabbit Polyclonal Antibody

SKU TA330694

Rabbit Polyclonal Anti-CBWD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CBWD1 antibody is: synthetic peptide directed towards the N-terminal region of Human CBWD1. Synthetic peptide located within the following region: GAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: COBW domain containing 1
• Database Link:
  NP_001138827
  Q9BRT8
• Background: The function of this protein remains unknown.
• Synonyms: COBP
• Note: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 85%; Yeast: 79%

Reference Data