ZCWPW1 Rabbit Polyclonal Antibody

SKU TA330663

Rabbit Polyclonal Anti-ZCWPW1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZCWPW1 antibody is: synthetic peptide directed towards the N-terminal region of Human ZCWPW1. Synthetic peptide located within the following region: KATMKNVPSREQEKKRKAQINKQAEKKEKEKSSLTNAEFEEIVQIVLQKS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 71 kDa
• Gene Name: zinc finger CW-type and PWWP domain containing 1
• Database Link:
  NP_060454
  Q9H0M4
• Background: The function of this protein remains unknown.
• Synonyms: ZCW1
• Note: Human: 100%; Pig: 92%; Dog: 85%; Horse: 85%; Rabbit: 85%

Reference Data