TBX21 Rabbit Polyclonal Antibody

SKU TA330627

Rabbit Polyclonal Anti-TBX21 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the middle region of human TBX21. Synthetic peptide located within the following region: SIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: T-box 21
• Database Link:
  NP_037483
  Q9UL17
• Background: TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. It is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.
• Synonyms: T-bet; T-PET; TBET; TBLYM
• Note: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors