HIPK2 Rabbit Polyclonal Antibody

SKU TA330617

Rabbit Polyclonal Anti-HIPK2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HIPK2 antibody is: synthetic peptide directed towards the middle region of Human HIPK2. Synthetic peptide located within the following region: MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 120 kDa
• Gene Name: homeodomain interacting protein kinase 2
• Database Link:
  NP_073577
  Q9H2X6
• Background: HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.
• Synonyms: PRO0593
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 87%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase, Transcription Factors