NPAS4 Rabbit Polyclonal Antibody

SKU TA330603

Rabbit Polyclonal Anti-NPAS4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NPAS4 antibody: synthetic peptide directed towards the middle region of human NPAS4. Synthetic peptide located within the following region: QAHLDSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 87 kDa
• Gene Name: neuronal PAS domain protein 4
• Database Link:
  NP_849195
  Q8IUM7
• Background: NXF is a member of the basic helix-loop-helix-PER (MIM 602260)-ARNT (MIM 126110)-SIM (see SIM2; MIM 600892) (bHLH-PAS) class of transcriptional regulators, which are involved in a wide range of physiologic and developmental events.NXF is a member of the basic helix-loop-helix-PER (MIM 602260)-ARNT (MIM 126110)-SIM (see SIM2; MIM 600892) (bHLH-PAS) class of transcriptional regulators, which are involved in a wide range of physiologic and developmental events (Ooe et al., 2004 [PubMed 14701734]). [supplied by OMIM]
• Synonyms: bHLHe79; Le-PAS; NXF; PASD10
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 93%; Horse: 86%; Sheep: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors