POU2F3 Rabbit Polyclonal Antibody

SKU TA330591

Rabbit Polyclonal Anti-POU2F3 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivity: Human, Mouse, Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POU2F3 antibody: synthetic peptide directed towards the N terminal of human POU2F3. Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 47 kDa
• Gene Name: POU class 2 homeobox 3
• Database Link:
  NP_055167
  Q9UKI9
• Background: POU domain genes encode a family of highly conserved transacting factors that influence the transcriptional activity of several cell type-specific and ubiquitous genes. Studies have cloned and sequenced cDNAs encoding a novel mouse POU domain protein, Oct-11, that is closely related within the POU domain to the POU class II proteins, Oct-1 and Oct-2.
• Synonyms: Epoc-1; OCT-11; OCT11; OTF-11; PLA-1; PLA1; Skn-1a
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%

Reference Data