ZKSCAN5 Rabbit Polyclonal Antibody

SKU TA330581

Rabbit Polyclonal Anti-ZKSCAN5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZKSCAN5 antibody: synthetic peptide directed towards the N terminal of human ZKSCAN5. Synthetic peptide located within the following region: VKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITSMGYESRDN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 97 kDa
• Gene Name: zinc finger with KRAB and SCAN domains 5
• Database Link:
  NP_659570
  Q9Y2L8
• Background: ZKSCAN5 may be involved in transcriptional regulation.This gene encodes a zinc finger protein of the Kruppel family. The protein contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis. Two alternatively spliced transcript variants differing only in the 5' UTR have been described. Additional variants have been found, but their full-length sequences have not been determined.
• Synonyms: ZFP95; ZNF914; ZSCAN37
• Note: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Rabbit: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors