SRC3 (NCOA3) Rabbit Polyclonal Antibody

SKU TA330568

Rabbit Polyclonal Anti-NCOA3 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NCOA3 antibody: synthetic peptide directed towards the middle region of human NCOA3. Synthetic peptide located within the following region: DQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 155 kDa
• Gene Name: nuclear receptor coactivator 3
• Database Link:
  NP_006525
  Q9Y6Q9
• Background: NCOA3 is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Two transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein.The protein encoded by this gene is a nuclear receptor coactivator that interacts with nuclear hormone receptors to enhance their transcriptional activator functions. The encoded protein has histone acetyltransferase activity and recruits p300/CBP-associated factor and CREB binding protein as part of a multisubunit coactivation complex. This protein is initially found in the cytoplasm but is translocated into the nucleus upon phosphorylation. Two transcript variants encoding different isoforms have been found for this gene. In addition, a polymorphic repeat region is found in the C-terminus of the encoded protein.
• Synonyms: ACTR; AIB-1; AIB1; bHLHe42; CAGH16; CTG26; KAT13B; pCIP; RAC3; SRC-3; SRC3; TNRC14; TNRC16; TRAM-1
• Note: Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Dog: 90%; Mouse: 83%; Bovine: 77%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors