NCOR2 Rabbit Polyclonal Antibody

SKU TA330552

Rabbit Polyclonal Anti-NCOR2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NCOR2 antibody: synthetic peptide directed towards the N terminal of human NCOR2. Synthetic peptide located within the following region: PMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 275 kDa
• Gene Name: nuclear receptor corepressor 2
• Database Link:
  NP_006303
  Q9Y618
• Background: NCOR2 forms a large corepressor complex that contains SIN3A/B and histone deacetylases HDAC1 and HDAC2. This complex associates with the thyroid (TR) and the retinoid acid receptors (RAR) in the absence of ligand, and may stabilize their interaction with TFIIB. NCOR2 mediates the transcriptional repression activity of some nuclear receptors by promoting chromatin condensation, thus preventing access of the basal transcription.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
• Synonyms: CTG26; N-CoR2; SMAP270; SMRT; SMRTE; SMRTE-tau; TNRC14; TRAC; TRAC-1; TRAC1
• Note: Pig: 100%; Human: 100%; Bovine: 93%; Yeast: 87%; Dog: 86%; Rat: 86%; Mouse: 86%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Notch signaling pathway