LHX3 Rabbit Polyclonal Antibody

SKU TA330540

Rabbit Polyclonal Anti-LHX3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LHX3 antibody: synthetic peptide directed towards the middle region of human LHX3. Synthetic peptide located within the following region: NMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: LIM homeobox 3
• Database Link:
  NP_835258
  Q9UBR4
• Background: LHX3 is a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. Two transcripts variants encoding distinct isoforms have been identified for this gene.
• Synonyms: CPHD3; LIM3; M2-LHX3
• Note: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Zebrafish: 92%; Guinea pig: 87%; Dog: 86%; Mouse: 86%; Horse: 85%

Reference Data

• Protein Families: Druggable Genome