NEUROD6 Rabbit Polyclonal Antibody

SKU TA330529

Rabbit Polyclonal Anti-NEUROD6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NEUROD6 antibody: synthetic peptide directed towards the N terminal of human NEUROD6. Synthetic peptide located within the following region: MCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDRE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: neuronal differentiation 6
• Database Link:
  NP_073565
  Q96NK8
• Background: NEUROD6 contains 1 basic helix-loop-helix (bHLH) domain. It activates E box-dependent transcription in collaboration with TCF3/E47 and may be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. It transactivates the promoter of its own gene.
• Synonyms: Atoh2; bHLHa2; Math-2; MATH2; Nex1; NEX1M
• Note: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors