RNF182 Rabbit Polyclonal Antibody

CAT#: TA330520

Reviews ()
Write a review

Rabbit Polyclonal Anti-RNF182 Antibody



Get 29% off any Over-Expression Cell Lysate, a validated WB control, with any Ab purchase. Use code “OEL29“. View details.

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RNF182 antibody: synthetic peptide directed towards the middle region of human RNF182. Synthetic peptide located within the following region: LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 27 kDa
Gene Name ring finger protein 182
Background RNF182 is a multi-pass membrane protein. It contains 1 RING-type zinc finger. The function of RNF182 remains unknown.
Synonyms FLJ40772; MGC33993
Note Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 92%; Bovine: 87%
Reference Data
Protein Families Druggable Genome, Transmembrane
Other products for "RNF182"
Frequently bought together (2)
Transient overexpression lysate of ring finger protein 182 (RNF182), transcript variant 2
    • 100 ug

USD 360.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies