RNF182 Rabbit Polyclonal Antibody

SKU TA330520

Rabbit Polyclonal Anti-RNF182 Antibody

Product Data

• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RNF182 antibody: synthetic peptide directed towards the middle region of human RNF182. Synthetic peptide located within the following region: LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 27 kDa
• Gene Name: ring finger protein 182
• Database Link:
  NP_689950
  Q8N6D2
• Background: RNF182 is a multi-pass membrane protein. It contains 1 RING-type zinc finger. The function of RNF182 remains unknown.
• Synonyms: FLJ40772; MGC33993
• Note: Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 92%; Bovine: 87%

Reference Data

• Protein Families: Druggable Genome, Transmembrane