HTR2C Rabbit Polyclonal Antibody

SKU TA330447

Rabbit Polyclonal Anti-HTR2C Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HTR2C antibody: synthetic peptide directed towards the N terminal of human HTR2C. Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 52 kDa
• Gene Name: 5-hydroxytryptamine receptor 2C
• Database Link:
  NP_000859
  P28335
• Background: This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with g proteins that activate a phosphatidylinositol . calcium second messenger system.
• Synonyms: 5-HT1C; 5-HT2C; 5-HTR2C; 5HTR2C; HTR1C
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Mouse: 86%; Rat: 85%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Calcium signaling pathway, Gap junction, Neuroactive ligand-receptor interaction