HTR1B Rabbit Polyclonal Antibody

SKU TA330445

Rabbit Polyclonal Anti-HTR1B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HTR1B antibody: synthetic peptide directed towards the N terminal of human HTR1B. Synthetic peptide located within the following region: MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: 5-hydroxytryptamine receptor 1B
• Database Link:
  NP_000854
  P28222
• Background: The pathophysiology of depression remains enigmatic, although abnormalities that involve serotonin signaling have been implicated. The serotonin 1B receptor [5-hydroxytryptamine (5-HT1B) receptor] interacts with p11. p11 increases localization of 5-HT1B receptors at the cell surface. p11 is increased in rodent brains by antidepressants or electroconvulsive therapy, but decreased in an animal model of depression and in brain tissue from depressed patients. Overexpression of p11 increases 5-HT1B receptor function in cells and recapitulates certain behaviors seen after antidepressant treatment in mice. p11 knockout mice exhibit a depression-like phenotype and have reduced responsiveness to 5-HT1B receptor agonists and reduced behavioral reactions to an antidepressant.
• Synonyms: 5-HT1B; 5-HT1DB; HTR1D2; HTR1DB; S12
• Note: Immunogen sequence homology: Chimpanzee:100%; Lowland gorilla:100%; Human:100%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction