CHRNB3 Rabbit Polyclonal Antibody

CAT#: TA330428

Reviews ()
Write a review

Rabbit Polyclonal Anti-CHRNB3 Antibody



Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CHRNB3 antibody: synthetic peptide directed towards the middle region of human CHRNB3. Synthetic peptide located within the following region: YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 53 kDa
Gene Name cholinergic receptor nicotinic beta 3 subunit
Background Nicotinic acetylcholine receptors (nAChRs) are ligand-gated ion channels nAChRs are pentameric structures that are made up of combinations of individual subunits. CHRNB3 is one of the subunits of nAChR. Twelve neuronal nAChR subunits have been described, alpha2-alpha10 and beta2-beta4. CHRNB3 decreased the channel mean open time and burst length. There was also an increase in single channel slope conductance. On the other hand, the calcium permeability and the pharmacological properties of beta3-containing receptors differed little from those of without beta3. Dysfunction of nAChR has been linked to a number of human diseases such as schizophrenia, Alzheimer's and Parkinson's diseases. nAChRs also play a significant role in nicotine addiction.
Synonyms acetylcholine receptor; beta-3 subunit; beta 3; beta polypeptide 3; cholinergic receptor; neuronal nicotinic; nicotinic
Note Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Horse: 93%; African clawed frog: 76%
Reference Data
Protein Families Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
Other products for "CHRNB3"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies