CHRNB3 Rabbit Polyclonal Antibody

SKU TA330428

Rabbit Polyclonal Anti-CHRNB3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHRNB3 antibody: synthetic peptide directed towards the middle region of human CHRNB3. Synthetic peptide located within the following region: YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 53 kDa
• Gene Name: cholinergic receptor nicotinic beta 3 subunit
• Database Link:
  NP_000740
  Q05901
• Background: Nicotinic acetylcholine receptors (nAChRs) are ligand-gated ion channels nAChRs are pentameric structures that are made up of combinations of individual subunits. CHRNB3 is one of the subunits of nAChR. Twelve neuronal nAChR subunits have been described, alpha2-alpha10 and beta2-beta4. CHRNB3 decreased the channel mean open time and burst length. There was also an increase in single channel slope conductance. On the other hand, the calcium permeability and the pharmacological properties of beta3-containing receptors differed little from those of without beta3. Dysfunction of nAChR has been linked to a number of human diseases such as schizophrenia, Alzheimer's and Parkinson's diseases. nAChRs also play a significant role in nicotine addiction.
• Synonyms: acetylcholine receptor; beta-3 subunit; beta 3; beta polypeptide 3; cholinergic receptor; neuronal nicotinic; nicotinic
• Note: Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Horse: 93%; African clawed frog: 76%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane