GPR15 Rabbit Polyclonal Antibody

SKU TA330386

Rabbit Polyclonal Anti-GPR15 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPR15 antibody: synthetic peptide directed towards the N terminal of human GPR15. Synthetic peptide located within the following region: FIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: G protein-coupled receptor 15
• Database Link:
  NP_005281
  P49685
• Background: GPR15 is a probable chemokine receptor. GPR15 is also an alternative coreceptor with CD4 for HIV-1 infection.
• Synonyms: BOB
• Note: Immunogen sequence homology: Bovine: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Dog: 86%; Chicken: 80%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane