KBTBD11 Rabbit Polyclonal Antibody

SKU
TA330305
Rabbit Polyclonal Anti-KBTBD11 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-KBTBD11 antibody is: synthetic peptide directed towards the middle region of Human KBTBD11. Synthetic peptide located within the following region: LGPAGERAGSRPQSPSGDADARGDAAVYCFHAAAGEWRELTRLPEGAPAR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 70 kDa
Gene Name kelch repeat and BTB domain containing 11
Database Link
Background The function of this protein remains unknown.
Synonyms KLHDC7C
Note Immunogen sequence homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 86%; Bovine: 79%
Reference Data
Write Your Own Review
You're reviewing:KBTBD11 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.